Web stats for Cheapseats - cheapseats.com
2.17 Rating by ClearWebStats
cheapseats.com is 2 decades 8 years 5 months old. This website has a #1,178,220 rank in global traffic. It has a .com as an domain extension. This website has a Google PageRank of 3 out of 10. This domain is estimated value of $ 720.00 and has a daily earning of $ 3.00. While no active threats were reported recently by users, cheapseats.com is SAFE to browse.
Traffic Report of Cheapseats
Daily Unique Visitors: | 408 |
Daily Pageviews: | 816 |
Estimated Valuation
Income Per Day: | $ 3.00 |
Estimated Worth: | $ 720.00 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Yahoo Indexed Pages: | Not Applicable |
Bing Indexed Pages: | 7 |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | 10 |
Alexa BackLinks: | 192 |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Privacy: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Google Pagerank
PR 3 out of 10
PageSpeed Score
50
Siteadvisor Rating
Not Applicable
Where is cheapseats.com server located?
Social Engagement
Facebook Shares: | 35 |
Facebook Likes: | 16 |
Facebook Comments: | 14 |
Twitter Count (Tweets): | Not Applicable |
Linkedin Shares: | Not Applicable |
Delicious Shares: | Not Applicable |
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | Not Applicable | H2 Headings: | Not Applicable |
H3 Headings: | 8 | H4 Headings: | 2 |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | 33 |
Google Adsense: | Not Applicable | Google Analytics: | UA-4738062-2 |
HTTP Header Analysis
Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Fri, 13 Jun 2014 12:47:55 GMT
Server: Apache/2.2.26 (Unix) mod_ssl/2.2.26 OpenSSL/1.0.1e-fips mod_bwlimited/1.4
X-Powered-By: PHP/5.4.26
Transfer-Encoding: chunked
Content-Type: text/html
Status-Code: 200
Status: 200 OK
Date: Fri, 13 Jun 2014 12:47:55 GMT
Server: Apache/2.2.26 (Unix) mod_ssl/2.2.26 OpenSSL/1.0.1e-fips mod_bwlimited/1.4
X-Powered-By: PHP/5.4.26
Transfer-Encoding: chunked
Content-Type: text/html
Domain Information for cheapseats.com
Domain Nameserver Information
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
cheapseats.com | A | 285 |
IP:8.20.56.181 |
cheapseats.com | NS | 300 |
Target:ns2.mdnsservice.com |
cheapseats.com | NS | 300 |
Target:ns3.mdnsservice.com |
cheapseats.com | NS | 300 |
Target:ns1.mdnsservice.com |
cheapseats.com | SOA | 300 |
MNAME:ns1.mdnsservice.com RNAME:hostmaster.mdnsservice.com Serial:1572642002 Refresh:10001 Retry:7200 Expire:2419200 |
cheapseats.com | MX | 300 |
Priority:10 Target:mail.cheapseats.com |
Similarly Ranked Websites to Cheapseats
Terri Johnson Creates
- terrijohnsoncreates.com
Sharing Tips and Tutorials for my Sewing, Embroidery and Silhouette Cameo creations
.:: SRI SUBRAHMANYASWAMY DEVALAYAM SKANDAGIRI ::.
- srisubrahmanyaswamydevalayamskandagiri.org