2.17 Rating by ClearWebStats
cheapseats.com is 2 decades 8 years 5 months old. This website has a #1,178,220 rank in global traffic. It has a .com as an domain extension. This website has a Google PageRank of 3 out of 10. This domain is estimated value of $ 720.00 and has a daily earning of $ 3.00. While no active threats were reported recently by users, cheapseats.com is SAFE to browse.
Get Custom Widget

Traffic Report of Cheapseats

Daily Unique Visitors: 408
Daily Pageviews: 816

Estimated Valuation

Income Per Day: $ 3.00
Estimated Worth: $ 720.00

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: 7

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: 10
Alexa BackLinks: 192

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: View cheapseats.com Pagerank
Alexa Rank: 1,178,220
Domain Authority: Not Applicable
Google Pagerank
PR 3 out of 10
PageSpeed Score
50
Siteadvisor Rating
View cheapseats.com site advisor rating Not Applicable

Where is cheapseats.com server located?

Hosted IP Address:

8.20.56.181 View other site hosted with cheapseats.com

Hosted Country:

cheapseats.com hosted country US cheapseats.com hosted country

Location Latitude:

33.5779

Location Longitude:

-101.855

Social Engagement

Facebook Shares: 35
Facebook Likes: 16
Facebook Comments: 14
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable

Page Resources Breakdown

View cheapseats.com HTML resources

Homepage Links Analysis

Cheap Flights | Discount Airfare | Airline Tickets | Cheapseats.com

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: Not Applicable
H3 Headings: 8 H4 Headings: 2
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 33
Google Adsense: Not Applicable Google Analytics: UA-4738062-2

HTTP Header Analysis

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Fri, 13 Jun 2014 12:47:55 GMT
Server: Apache/2.2.26 (Unix) mod_ssl/2.2.26 OpenSSL/1.0.1e-fips mod_bwlimited/1.4
X-Powered-By: PHP/5.4.26
Transfer-Encoding: chunked
Content-Type: text/html

Domain Information for cheapseats.com

Domain Registrar: OMNIS NETWORK, LLC cheapseats.com registrar info
Registration Date: 1995-11-20 2 decades 8 years 5 months ago
Last Modified: 2010-06-30 1 decade 3 years 10 months ago
Expiration Date: 2016-12-07 7 years 5 months 2 days ago

Domain Nameserver Information

Host IP Address Country
ns1.mdnsservice.com cheapseats.com name server information 216.40.47.18 cheapseats.com server is located in Canada Canada
ns2.mdnsservice.com cheapseats.com name server information 64.98.148.11 cheapseats.com server is located in Canada Canada
ns3.mdnsservice.com cheapseats.com name server information 64.99.96.34 cheapseats.com server is located in Canada Canada

DNS Record Analysis

Host Type TTL Extra
cheapseats.com A 285 IP:8.20.56.181
cheapseats.com NS 300 Target:ns2.mdnsservice.com
cheapseats.com NS 300 Target:ns3.mdnsservice.com
cheapseats.com NS 300 Target:ns1.mdnsservice.com
cheapseats.com SOA 300 MNAME:ns1.mdnsservice.com
RNAME:hostmaster.mdnsservice.com
Serial:1572642002
Refresh:10001
Retry:7200
Expire:2419200
cheapseats.com MX 300 Priority:10
Target:mail.cheapseats.com

Similarly Ranked Websites to Cheapseats

Home

cheapseats.com favicon - jpccollection.be

View cheapseats.com Pagerank   Alexa rank for cheapseats.com 1,178,221   website value of cheapseats.com $ 720.00

Terri Johnson Creates

cheapseats.com favicon - terrijohnsoncreates.com

Sharing Tips and Tutorials for my Sewing, Embroidery and Silhouette Cameo creations

View cheapseats.com Pagerank   Alexa rank for cheapseats.com 1,178,221   website value of cheapseats.com $ 720.00

.:: SRI SUBRAHMANYASWAMY DEVALAYAM SKANDAGIRI ::.

cheapseats.com favicon - srisubrahmanyaswamydevalayamskandagiri.org

View cheapseats.com Pagerank   Alexa rank for cheapseats.com 1,178,223   website value of cheapseats.com $ 720.00

Error 406 - Not Acceptable

cheapseats.com favicon - redmondsgrill.com

View cheapseats.com Pagerank   Alexa rank for cheapseats.com 1,178,225   website value of cheapseats.com $ 720.00